Details
CLI arguments
benchstab [-h] [--include INCLUDE] [--exclude EXCLUDE] [--pred-type TYPE1 TYPE2]
[--config CONFIG] [--source SOURCE] [--output OUTPUT] [--verbose] [--quiet] [--skip-header] [--output OUTPUT] [--list-predictors] [--permissive] [--dry-run]
Description of the arguments:
--include INCLUDEallows the user to specify a subset of predictors, separated by a comma, from which the predictions will be acquired.--exclude EXCLUDEallows the user to specify the subset of predictors, separated by a comma, excluded in the process of acquiring predictions. If both--includeand--excludeare supplied,--excludewill be ignored.--pred-typeallows the user to define which protein formats will be used as inputs to the predictor. fo PossibleTypeoptions are (by default, all options are allowed):sequence- allow sequence-based predictors.structure- allow structure-enabled predictors, a PDB accession code is always preferred before PDB files.
--config CONFIGpredictor configuration file in.jsonformat. For a more detailed description, please refer to section Accepted file formats--source SOURCEmutation file, has to obey a specific format defined in the section Accepted file formats. If not supplied, the application will attempt to read from stdin.--verboseadds full logging of preprocessing errors and warnings, dataset summary and real-time prediction status updates. This will also include thestatus_messagefield in the results, providing more detailed information about the prediction status.--quietdisables all logging except for the prediction results and critical errors. Overrides the--verboseoption.--output OUTPUTfile path, where the folder with results will be created. If not supplied, the application will not attempt to store the prediction results.--permissiveif enabled, exceptions in mutation file parsing will be fatal.--list-predictorslists all implemented predictor clients.--dry-runif enabled, the application will not attempt to acquire predictions, but will only parse the mutation file and print the selected predictors to the console.--skip-headerIf enabled, the application will skip the first line of the provided mutation file.
If neither --include nor --exclude are supplied, the application will acquire predictions from all implemented predictors.
Output
During preprocessing, if the --verbose [1|2] option is enabled, if any problems are found in the mutation file, the application will log them along with their severity to the console. The severity levels are as follows:
INFO– information about the mutation file.WARNING– row in the mutation file contains invalid data, but the application will still attempt to acquire the prediction. Warnings are usually raised if:the provided PDB file, or PDB file from RCSB failed the BioPython’s validation.
in case of rows with PDB ID, the modified position does not match the sequence from UniProt.
in case of rows with PDB ID, the modified position does not match the sequence from RCSB.
in case of rows with PDB file, the modified position does not match the sequence in the PDB file.
ERROR- fatal errors that will prevent the application from acquiring the prediction.
If any errors are found, the application will raise an exception at the end of the preprocessing. If you wish to skip the invalid records and continue with the rest of the dataset, pass --permissive as an argument.
By default, BenchStab prints the prediction results to stdout in csv format. Together with the results, the application provides a short summary of the preprocessed dataset. If the --verbose [1|2] option is enabled, the application will also print the prediction status to the console. If the user provides a path via --output parameter, the BenchStab’s output is also saved to a folder with the name predictorclient_YYMMDD_HHMMSS in the user-specified location. The folder will contain the following files:
results.csv– exact copy of results printed to stdout. Contains the results of the prediction incsvformat. The file contains the following columns:identifier– protein identifiermutation– mutation in the formatoriginal_amino_acid$position$mutated_amino_acidchain– the chain identifier (only in the case of protein structures)DDG– predicted change in Gibbs free energystatus– predictor’s job status. Possible values are:finished– prediction has finished successfullywaiting– the program was terminated while waiting for resolutiontimeout– prediction timed out, no results were acquiredprocessing– the program was terminated while processingresponse parsing failed– failed to parse the predictor’s HTML responseconnection failed– failed to connect to the predictor’s webserverother failure– unexpected errorsfailed– predictor has failed to acquire the prediction, most likely due to the invalid protein/chain/mutation combinationOr a custom, predictor-specific error message
status_message– additional information about the prediction status. Populated only if--verbose 2option is enabledpredictor– predictor nameinput_type– type of predictor based on an accepted protein input format. Possible values are:PdbID– predictor accepts PDB accession codes.PdbFile– predictor accepts PDB files.Sequence– predictor accepts protein sequences.
url– URL of the results page on the predictor’s website. Populated only for job-based predictors. Useful if the user wants to extract additional information, check why the prediction failed or look at results in case of a timeout.Elapsed Time (sec.)– time elapsed between querying the predictor and the acquisition of the results.
Example of the
results.csvfile:identifier,mutation,chain,DDG,status,predictor,input_type,url,Elapsed Time (sec.) 1CSE,L45G,I,-2.5,finished,DDGun,Sequence,https://folding.biofold.org/cgi-bin/find-ddgun-job.cgi?njob=515416&wdir=ddgun-2de6fb21-6884-11ee-a05a-3d86aaaaaaaa,60.82 1CSE,L45A,I,-1.4,finished,DDGun,Sequence,https://folding.biofold.org/cgi-bin/find-ddgun-job.cgi?njob=515418&wdir=ddgun-2df7a2c2-6884-11ee-8b65-3d8e38e38e38,60.79 1CSE,L45G,I,,predictor not available,IMutant3,Sequence,http://gpcr.biocomp.unibo.it/cgi/predictors/I-Mutant3.0/I-Mutant3.0.cgi,0.0 1CSE,L45A,I,,predictor not available,IMutant3,Sequence,http://gpcr.biocomp.unibo.it/cgi/predictors/I-Mutant3.0/I-Mutant3.0.cgi,0.0 1CSE,L45G,I,Decrease,finished,iStable,Sequence,http://predictor.nchu.edu.tw/iStable/indexSeq.php,3.01 1CSE,L45A,I,Decrease,finished,iStable,Sequence,http://predictor.nchu.edu.tw/iStable/indexSeq.php,2.97 1CSE,L45G,I,-5.74,finished,IMutant2,Sequence,https://folding.biofold.org/i-mutant//www-data/output/Mut35437/output.html,60.64 1CSE,L45A,I,-4.46,finished,IMutant2,Sequence,https://folding.biofold.org/i-mutant//www-data/output/Mut35442/output.html,60.66 1CSE,L45G,I,-2.3847425,finished,Mupro,Sequence,http://mupro.proteomics.ics.uci.edu/cgi-bin/predict.pl,2.62 1CSE,L45A,I,-2.358147,finished,Mupro,Sequence,http://mupro.proteomics.ics.uci.edu/cgi-bin/predict.pl,2.02
preprocessed_input.csv– contains the processed mutation file incsvformat. The file is identical to the input mutation file, except for the addition of the following columns:identifier– protein identifiermutation– mutation in the formatoriginal_amino_acid$position$mutated_amino_acid.fasta_mutation- mutation in the formatoriginal_amino_acid$position$mutated_amino_acidadjusted to the acquired sequence. This is useful in the case of sequence-based predictors, where the mutation position is adjusted to the acquired sequence. In the case of structure-based predictors, this field is unused.chain– chain identifier (only in case of protein structures)ph– pH value of the environment (optional)temperature– temperature of the environment (optional)fasta– protein sequence in FASTA format
Example of the
preprocessed_input.csvfile (fasta sequence is shortened by...in the markdown):identifier,mutation,chain,fasta_mutation,fasta,ph,temperature 1C52,M69H,A,M69H,QADGAKIYA...,7,25 1C52,M69A,A,M69A,QADGAKIYA...,7,25
summary.json- contains the dataset summary injsonformat. The summary contains the following fields:mutations- number of mutations in the dataset.identifiers- number of proteins in the dataset.avg_mut- average number of mutations per protein.mut_positive- number of mutant amino acids with positive charge`.mut_negative- number of mutant amino acids with negative charge.mut_no_charge- number of mutant amino acids with no charge.mut_acidic- number of mutant amino acids with acidic properties`.mut_basic"- number of mutant amino acids with basic properties.mut_balanced- number of m utant amino acids with balanced properties.mut_polar- number of polar mutant amino acids.mut_nonpolar- number of non-polar mutant amino acids.
Example of the
summary.jsonfile:{ "mutations": 2, "identifiers": 2, "avg_mut": 1.0, "mut_positive": 0, "mut_negative": 0, "mut_no_charge": 2, "mut_acidic": 0, "mut_basic": 0, "mut_balanced": 0, "mut_polar": 0, "mut_nonpolar": 2 }
More usage examples
Minimal example: acquire prediction from all predictors (since no --exclude or --include parameters are supplied) on entry specified through pipe and print them to stdout:
echo 1CSE L45G I | benchstab
The option --pred-type can be used to further specify the type of the selected predictor used based on the input format. This is useful for predictors that accept both sequence and structure inputs. By default, the predictor client will acquire predictions from both structure-enabled and sequence-based predictors. If you wish to query only sequence-based predictors, you have to specify the --pred-type option:
echo 1CSE L45G I | benchstab --pred-type sequence
There is also a possibility of allowing multiple input types for predictors at once. For example, if you wish to acquire predictions from both sequence-based and structure-enabled, you can use the following command:
echo 1CSE L45G I | benchstab --pred-type sequence structure
There are multiple ways to specify the input file:
# as a file path argument
benchstab --source input.csv
# as a stdin input
echo 1CSE L45G I\n1CSE L45A I | benchstab
# or as a file through stdin
benchstab < input.csv
Where the example mutation file input.csv can look like this:
1CSE,L45G,I
1CSE,L45A,I
For the exact definition of the mutation file format, please refer to the Accepted file formats section.
benchstab will always export the results to stdout in csv format. If you wish to save the results to a file, you can use the --output option or redirect the stdout to a file (without --verbose option):
# save results to a file
benchstab --output results.csv < input.txt
# redirect stdout to a file
benchstab < input.txt > results.csv
By default, predictor manager operates in a strict mode, which means that it will raise an exception if any errors are found in the mutation file. If you wish to skip the invalid records and continue with the filtered dataset, pass permissive=False as a parameter in the preprocessor’s constructor.
benchstab --include automute --permissive < input.csv
If you wish to limit the amount of used predictor clients:
# acquire predictions from all predictors except `Automute` and `Cupsat`
benchstab --exclude automute cupsat < input.csv
# acquire predictions from `Automute` and `Cupsat` only
benchstab --include automute cupsat < input.csv
You can pass your own set of options to the predictor client. For example, if you wish to pass the login parameters to the PopMusic predictor:
First, you have to create a config file in
jsonformat (e.g.,config.json):
{
"popmusic": {
"username": "your_email",
"password": "your_password"
}
}
and then pass it to the predictor client as
--configoption:
benchstab --config config.json --include popmusic < input.csv
For a more detailed description of the predictor client’s options, please refer to the Configuration file section.
By default, the application will only print the prediction results to stdout. If you wish to see the preprocessing errors and warnings, dataset summary and real-time prediction status updates, you can use the --verbose option. Besides 0 which is deafault option, the --verbose option accepts 2 additional values:
1– adds full logging of preprocessing errors and warnings and dataset summary. Real-time prediction status updates are displayed in a single line in the console.echo 1THQ F55A A\n1CSE L45G I | benchstab --verbose 1 --include mupro --pred-type sequence # Using above command with verbosity level set to "1" will display the following output after the status change: INFO:iStableSequence (1/2): Status change in "1THQ":"F55A" to "finished". # After another status change, the previous output is wiped out and replaced by new information: INFO:iStableSequence (2/2): Status change in "1CSE":"L45G" to "finished".
2– adds full logging of preprocessing errors and warnings, dataset summary and real-time prediction status updates.echo 1THQ F55A A\n1CSE L45G I | benchstab --verbose 2 --include mupro --pred-type sequence # Using above command with verbosity level set to "2" will display the following output after the status change: INFO:iStableSequence (1/2): Status change in "1THQ":"F55A" to "finished". # After another change, the previous reports are preserved: INFO:iStableSequence (1/2): Status change in "1THQ":"F55A" to "finished". INFO:iStableSequence (2/2): Status change in "1CSE":"L45G" to "finished".
An example of a cascade acquisition of protein sequence from PDB ID is mentioned in Accepted file formats. The sequence acquired from UniProt fails the validation, but the sequence acquired from RCSB is valid:
echo 1THQ F55A A | benchstab.exe --include mupro --verbose 1 --pred-type sequence
Python library
Example usage of BenchStab
from benchstab import BenchStab
client = BenchStab(input_file="input.txt")
results = client()
(example-usage-of-preprocessor-singular-predictor)
Example usage of preprocessor/singular predictor
import asyncio
from benchstab import Preprocessor
from benchstab.predictors.web import INPSPdbID
data = Preprocessor(input="data.txt").parse()
pred = INPSPdbID(data=data)
results = asyncio.get_event_loop().run_until_complete(pred.compute())
Preprocessor:
By default, the
Preprocessorclass uses the flagpermissive=True, which raises an exception at the end of the preprocessing, if any errors were found. This is to prevent the submission of invalid proteins/mutations to predictor servers, which can lead to slowdowns in the prediction acquisition process. If you wish to skip the invalid records and continue with the filtered dataset, passpermissive=Falseas a parameter in the preprocessor’s constructor.By not setting the parameter
outfolder(or setting it asNone), thePreprocessor` will not attempt to save the processed dataset.As an
inputparameter, the preprocessor accepts 3 different types:File path (
str).\n-separated string mimicking the file (str).Input rows as a string list elements (
List[str]).
Accepted file formats
Mutation file
The predictor client accepts a single file with proteins and their mutations in .txt, .csv or .tsv format. Currently, only space, tab, comma and semicolon symbols are supported as column separators. The column structure of the mutation file has to be strictly adhered to, and it is defined as:
$identifier $mutation $chain ?ph ?temperature
where identifier, mutation, and chain (only in case of protein structures – PDB ID or file) params are required, while ph + temperature are optional. Accepted protein inputs are:
PDB accession code (e.g.,
1CSE)If a user provides PDB accession code, the application will attempt to also acquire the protein sequence firstly from UniProt, and if that fails, from RCSB. This allows the user to query sequence-based predictors by providing only the PDB accession code.
If the sequence does not exist in UniProt, or the adjusted mutation does not match the acquired sequence, the application will raise a warning. Since the sequence length and positions sometimes differ between UniProt and RCSB, the application will adjust the mutation position. For example, if the mutation
L45Gis provided, but the sequence acquired from UniProt is shorter by 2 amino acids, the application will adjust the mutation toL43Gbefore validating. Both mutations are kept in the dataset and used based on the predictor`s input type.If preprocessor fails to acquire the sequence from UniProt, it will attempt to acquire it from RCSB. If the provided mutation does not match the sequence acquired from RCSB, the application will raise a warning.
If preprocessor fails to acquire the sequence from both UniProt and RCSB, dataset won`t contain the sequence record. This will lead to the failure of all sequence-based predictors on a given record.
UniProt accession code (e.g.,
P05067)path to a PDB structural file (
.pdb), for example./1CSE.pdb.When needed, the sequence is inferred from the PDB file. If the mutated position does not match the sequence, the application will raise a warning, and all sequence-based predictors will automatically fail on this record.
BenchStab extracts the sequence from the
seqrespart of the PDB file via BioPython’sSeqIOmodule. This approach assumes that the sequence indexing in the PDB file starts at0. If the sequence indexing starts at a different number, the user has to manually adjust the mutation position in the mutation file. Otherwise, the application will raise a warning and all sequence-based predictors will automatically fail on this record.
path to a FASTA sequence file (
.fasta). for example./1CSE.fasta.Raw fasta sequence without header (e.g.,
TEFGSELKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG)
Different protein identifiers can be combined, so the final mutation file muts.txt can look like this:
1CSE L45G I
P05067 A1B
./1CSE.pdb L45A I
./1CSE.fasta F10I
TEFGSELKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG L45G
Configuration file
The configuration file is in .json format and contains both general and predictor-specific settings. The configuration file is optional, and if not supplied, the application will use the default settings. An example of a configuration file (e.g., config.json) could be:
{
//General settings
"wait_interval": 60,
"max_retries": 100,
"batch_size": 5,
//Predictor-specific configuration
"popmusic": {
"username": "email@email.com",
"password": "very strong password"
},
"ddgun": { "max_retries": 10 },
"automute": { "model_type": "svm" },
"premps": {} // this can be repeated for every predictor
}
General:
"max_retries"Maximum amount of times to check the job’s status before timing out."wait_interval"Time (in seconds) between each job status check."batch_size"maximum concurrent requests sent to the predictor.Be careful, setting this parameter too high might cause denial of service attacks in case of some predictors.
If
-1is passed, all requests will be sent at once.
Predictor-specific: They are unique to the source implementation of each specific predictor. You can find them described in the
benchstab/predictors/web/<predictor_name>subfolder.
The predictor settings are applied in the following order:
Default predictor settings.
General settings in the configuration file.
Predictor-specific settings in the configuration file.
So the predictor-specific settings have the highest priority and always overwrite all other options. Each predictor has its own set of unique default settings, you can view their definition in:
.jsonformat, specified in README located in predictor’s subfolder –benchstab/predictors/web/<predictor_name>.pythonformat, defined in base predictor implementation found inbenchstab/predictors/web/<predictor_name>/base.py.
Steps for implementing new predictor
Create a new folder in
benchstab/predictors/web/with the name of the predictor. In this folder:Create a file
base.pyfor the predictor’s general implementation.class _PremPS(BaseGetPredictor): ...
Depending on the input format accepted by the predictor, create files
id.py,file.pyandsequence.pyin the created folder. These files will contain the predictor’s implementations for each format, inherited from thebase.pyfile. Usually, these files will only contain theprepare_payloadmethod, and sometimes theformat_mutationmethod.prepare_payloadprocesses the DatasetRow object and returns a dictionary with the payload for the POST request.format_mutationis used to format the mutation in the format accepted by the predictor. This method is optional, and if not implemented, the mutation will be formatted asoriginal_amino_acid$position$mutated_amino_acid. If the mutation format is the same for every input format, it is recommended to implement this method in thebase.pyfile.
class PremPSPdbID(_PremPS): def prepare_payload(self, row: pd.Series) -> Dict: return { 'example': '0', 'pdb_id': row['identifier'].id, 'pdb_mol': self.pdb_mol, 'bioassembly': self.bioassembly, 'isPl': self.is_pl, 'pdb_file': '' }
Create a new file
__init__.pyimporting all implementations, e.g.:from .id import PremPSPdbID from .file import PremPSPdbFile
Implement the
baseclass by adhering to all necessary steps described in the section about simple predictors.If the implemented predictor employs prediction queues or uses jobs, you will also have to follow the steps in the section about job-based predictors.
If the implemented predictor requires authentication, also follow the steps in the section about authentication predictors.
Include the predictor in the
benchstab/predictors/web/__init__.pyfile.from .premps import PremPSPdbID, PremPSPdbFile
The base predictor class will have to inherit from the
BasePostPredictorclass.class _DUET(BasePostPredictor): ...
The
BasePostPredictorimplements the logic for sending a POST request to the predictor’s webserver. To execute your logic before sending the POST request, you can override thesend_querymethod and add your code.class _DUET(BasePostPredictor): ... async def send_query(self, session, index: int, *args, **kwargs): # do something return await super().send_query(session, index, *args, **kwargs)
A. Predictors with instant results
Each call of
send_querycalls aget_post_handler, which is used to parse the response and set the adequate status. This method is not implemented in the base class and has to be implemented in the predictor’s implementation.async def default_post_handler(self, index, response, session): # It is an asynchronous request, so we have to await the response # Use the custom HTML parser to parse the response, if possible _res = self.html_parser.with_xpath( xpath="//div[@class = 'span4']/div[@class = 'well']", html=await response.text() ) _duet = self.html_parser.with_xpath(xpath='./font[3]/text()', root=_res) _ddg = re.findall(r'[\-+]?\d*\.\d+', _duet) # If the response does not contain the following string, the prediction has failed if not _ddg: self.data.update_status(index, status.Failed()) return False # Set the prediction results self.data.loc[index, 'DDG'] = float(_ddg[0]) # Change the status to finished # If you are implementing the predictor with jobs, you should set the status to blocking – Processing/Waiting self.data.update_status(index, status.Finished()) self.data.loc[index, 'url'] = response.url return True
B. Job-based predictors
The base predictor class will also have to inherit from the
BaseGetPredictorclass (no need to inherit fromBasePostPredictoranymore).class _PremPS(BaseGetPredictor): ...
The
BastGetPredictorimplements the loop in which the predictor will check the status of the job. The loop will run until the job is finished or the maximum number of retries is reached. The loop will also check if the job has timed out. If the job has timed out, the predictor will raise aTimeoutErrorexception. The maximum number of retries and the wait interval between each status check can be set in the predictor’s configuration file.By default, it will check the status of the job and wait for the specified amount of time between each check. If you wish to add extra operations before or after the status check, you can override the
retrieve_resultmethod and implement your logic.class _PremPS(BaseGetPredictor): ... async def retrieve_result(self, session, index) -> Response: # do something return await super().retrieve_result(session, index)
Usually, the dataset’s method
is_blocking_statusis used to determine if the status is blocking.
Each call of
retrieve_resultscalls aget_default_handler, which is used to parse the response and set the adequate status. This method is not implemented in the base class and has to be implemented in the predictor’s implementation.async def default_get_handler(self, index, response, session): # It is an asynchronous request, so we have to await the response _text = await response.text() # If the response contains the following string, the job is still running if 'This page will reload automatically in 30 seconds' in _text: return False # Use the custom HTML parser to parse the response, if possible _df = self.html_parser.with_pandas(_text, index=1) # Format the DataFrame to match the output format _df = _df.rename( {'Mutation': 'mutation', 'Mutated Chain': 'chain', 'ΔΔG': 'DDG'}, axis=1 ) _df = _df.drop(['Structure', 'Location'], axis=1) _df['identifier'] = self.data.loc[index, 'identifier'] # Update status self.data.update_status(index, status.Finished()) self.data.loc[index, 'url'] = response.url # Append the results to the list of results self._prediction_results.append(_df) # Return True to stop the loop return True
C. Predictors requiring authentication
The base predictor class will also have to inherit from
BaseAuthPredictorclass.class _PoPMuSiC(BaseAuthentication, BaseGetPredictor): # Optional, only if the custom authentication payload is required credentials = PoPMuSiCCredentials ...
If your predictor requires a custom authentication payload, different from the one provided by
BaseCredentialsimplemented inpredictors.base, you will have to create your own customcredentialsclass. This class has to inherit fromBaseCredentialsand implement theget_payloadmethod, which will return a dictionary with the authentication payload.@dataclass class PoPMuSiCCredentials(BaseCredentials): def get_payload(self, csrf): return { "_csrf_token": csrf, "_username": self.username, "_password": self.password, "_submit": "Login", }
If you need to process your authentication request (e.g., process CSRF token), you can do so in
login_handler. By default, it will only check if the authentication was successful by checking the response’s status code. If you need to process the response further, you can override this method.class _PoPMuSiC(BaseAuthentication, BaseGetPredictor): ... async def login_handler(self, response: Response) -> bool: return response.status_code == 200
Authentication is usually the first step in the prediction acquisition process. If you wish to add extra operations before the authentication, you can override the
loginmethod and implement your logic.class _PoPMuSiC(BaseAuthentication, BaseGetPredictor): ... async def login(self, session, index) -> bool: # do something return await super().login(session, index) async def login_handler(self, response: Response) -> bool: return response.status_code == 200