Úkoly z reálné praxe I.

1. Identifikace nových halogenalkandehalogenas
Experimentálně charakterizovaná halogenalkandehalogenasa LinB z bakterie Sphingobium japonicum:

>LinB (P51698)
MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIA
CDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARR
HRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILR
PLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLF
INAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA

CÍL: získat (putativní) halogenalkandehalogenasy z myši

Nápověda:
  • nalezněte putativní halogenalkadehalogenasy v genomu myši (Mus musculus)
  • prozkoumejte funkci nalezených proteinů
  • získejte informace o příslušném genu/genech (nutné pro vyžádání genu od autorů
    resp. genovou syntézu)

2. Předpověď funkce "neznámeho" DNA fragmentu
>neznamy_fragment
AGAATGGCCCATATCTTAAAACCCAAGGGAGATGCGATTGTTTTTCAGCCCTCGGTTATT
TATATCTGGAAAAACATAATGCCTCATCTGGAGGGTCTTGGAAGGCTCGTGGCATGTGAA
CTTATCATGCGGGCCACGGAACTACTTAGTCCTTCCGGCCCTGATAGACATTCATATGGT
GAGCAACGGGATTTTCTCTTTGCACTTTGGGATGCGTTAGACTTAGGCGACCACGTCGTC
GTTGTTCTCCATAATTATGGCTCGGCACTTGGCTTCGATTGGGCCAATCAACATAGGAAA
AAGGTCCAGGGTATCGCTTTCATGGAGGCAATAGTTACCCCGATGACTTGGGCGGATTGG
CCTCCAGCAGTACGGGGTGTATTTCAGGGGTTCAGAAGCCCGCAGGGGGAGCCGATGGCC
CTAGAGCACAAAATTTTTGTCGAGAGAGTGCTACCCGGTGCAATATTGAGGCAGTTGAGT
GACGAGGAGATGAATCACTGGAGACGCCCTTACGTCAACGGCGGGGAAGACAAGCGCCCA
ACGCTTAGCTGGCCGAGAAACCTCCCTATCGATGGTGAGCCGGCTGAAGTAGTGGCCCTT
GTTAATGAATACCGAAGCTGGATAGAAGAGACAGATATGCCGAAACTGTTTATTAACGCA
GAGCCTGGGGCGATTATCACTGGACGGATTCGAGATTACGTACGCTCGTGGCCAAATCAG
ACAGAGATCACCGTGCCGGGTGTTGGCTTTGTGCAAGAAGACTCTCCCGAAGAAATCGGA
GCTGCCATAGCGCAGTTTGTTCGGCGTTTGAGATCGG

CÍL: získat informace o potenciální funkci daného fragmentu

Nápověda:
  • identifikujte translační produkt
  • identifikujte proteinovou rodinu (sekvenční identita alespoň ~ 20% - 30%)
  • vyberte několik reprezentativních sekvencí z dané rodiny (preferenčně
    experimentálně charakterizované)

  • identifikujte vysoce konzervované oblasti a rezidua důležitá pro funkci


MENDELOVO CENTRUM pro vzdělávání v biologii, biomedicíně a bioinformatice CZ.1.07/2.3.00/09.0186

Aktuální cvičení:

Další informace:
Cvičení
Nukl. kyseliny
Proteiny
Struktury
Nástroje
Ke stažení
Bioinformatika - proteiny
Bioinformatika - nukl. kyseliny
Bioinformatické databáze
Manipulace se sekvenčními daty
Párové sekvenční přiložení
Mnohonásobné sekvenční přiložení
Návrh primerů
Hledání a identifikace genů
Analýza proteinových sekvencí
Anotace sekvence pro databáze
Strukturní databáze
Předpověď struktury proteinů
GenBank
EMBL-Bank
DDBJ
dbEST
UniGene
UniProtKB
NRDB
PIR
PROSITE
Pfam
INTERPRO
PDB
MMDB
PDBsum
CATH
SCOP
BLAST
FASTA
LALIGN
ClustalW
T-Coffee
MUSCLE
PSIPRED
JPRED
PHD
PuTTY
WinSCP
SPdbV
PyMOL
RasMol
BioEdit
MEGA3
TreeView